Triple AgonistMost PopularHover to zoomVials — Triple Agonist
Retatrutide
Triple-receptor agonist engineered for the most dramatic composition results.
View lab testing & COAs →- Regular
- …
- Elite Member−10%
- —
Research Use Only
This product is intended exclusively for laboratory and research purposes. Not for human or animal consumption.
Retatrutide is an investigational triple receptor agonist targeting GLP-1, GIP, and glucagon pathways, supplied as a lyophilized peptide. Manufactured to research-grade purity.
Research contexts include multi-receptor incretin signaling, energy expenditure modeling, lipolysis, and metabolic pathway characterization.
Research Use Only. This product is intended exclusively for laboratory research and is not approved for human or veterinary use.
The next frontier.
Triple Pathway
GLP-1, GIP, and glucagon receptors engaged simultaneously.
Energy Expenditure
Glucagon arm lifts resting energy use during a cut.
Aggressive Timeline
For operators wanting the steepest composition curve available.
Ingredients, disclosed.
Every compound. Every dose. Nothing proprietary, nothing hidden.
Composition, documented.
- Molecular Formula
- C221H343N51O64
- Molar Mass
- 4731.4 g/mol
- Amino Acid Sequence
- Y-Aib-QGTFTSDYSIYLDKQAAX-EFVQWLIAGGPSKGIVEQCCTSICSLYQLENYCN (triple agonist backbone)
- Synonyms
- LY3437943, GLP-1/GIP/Glucagon triple agonist
- Solubility
- Water-soluble
- Organoleptic Profile
- White to off-white powder
- Composition
- Lyophilized powder
