Insulin-Like GFHover to zoomVials — IGF-1
IGF-1 LR3
The long-acting IGF-1 analog — for athletes pursuing serious hypertrophy and recovery.
View lab testing & COAs →- Regular
- …
- Elite Member−10%
- —
Research Use Only
This product is intended exclusively for laboratory and research purposes. Not for human or animal consumption.
IGF-1 LR3 is a modified long-arginine-3 analog of insulin-like growth factor-1, supplied as a lyophilized research peptide. Manufactured to a high-purity standard.
Research applications include IGF-1 receptor signaling, IGFBP binding studies, satellite cell activity, and hypertrophy pathway modeling.
Research Use Only. This product is intended exclusively for laboratory research and is not approved for human or veterinary use.
Hyperplasia, accessible.
Long-Acting IGF-1
Extended half-life for sustained anabolic signaling.
Cellular Uptake
Used in advanced physique protocols for nutrient partitioning.
Site Targeting
Often dosed near worked tissue for localized response.
Ingredients, disclosed.
Every compound. Every dose. Nothing proprietary, nothing hidden.
Composition, documented.
- Molecular Formula
- C400H625N111O115S9
- Molar Mass
- 9117.4 g/mol
- Amino Acid Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Arg3 substitution, N-terminal 13-aa extension)
- Synonyms
- Long-R3 IGF-1, insulin-like growth factor 1 analog
- Solubility
- Water-soluble
- Organoleptic Profile
- White to off-white powder
- Composition
- Lyophilized powder
