Amylin AnalogHover to zoomVials — Amylin
Cagrilintide
Long-acting amylin analog. Designed to stack with GLP-1 protocols.
View lab testing & COAs →- Regular
- …
- Elite Member−10%
- —
Research Use Only
This product is intended exclusively for laboratory and research purposes. Not for human or animal consumption.
Cagrilintide is a long-acting amylin analog supplied as a lyophilized research peptide. Prepared for laboratory analytical applications.
Studied in amylin receptor pharmacology, satiety signaling, gastric emptying, and combined-incretin research protocols.
Research Use Only. This product is intended exclusively for laboratory research and is not approved for human or veterinary use.
Satiety, sustained.
Amylin Pathway
Targets a satiety mechanism distinct from GLP-1.
Stack Multiplier
Pairs with tirzepatide or semaglutide for compounded appetite control.
Glycemic Smoothing
Slows gastric emptying for steadier post-meal glucose.
Ingredients, disclosed.
Every compound. Every dose. Nothing proprietary, nothing hidden.
Composition, documented.
- Molecular Formula
- C171H271N51O51
- Molar Mass
- 3820.4 g/mol
- Amino Acid Sequence
- KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (K conjugated to C18 diacid)
- Synonyms
- AM-833, long-acting amylin analog
- Solubility
- Water-soluble
- Organoleptic Profile
- White to off-white powder
- Composition
- Lyophilized powder
